Lineage for d1n4xi_ (1n4x I:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782409Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity
    Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 782412Domain d1n4xi_: 1n4x I: [85325]
    Other proteins in same PDB: d1n4xl_, d1n4xm_
    part of scFv 1695
    complexed with cl

Details for d1n4xi_

PDB Entry: 1n4x (more details), 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph
PDB Compounds: (I:) immunoglobulin heavy chain variable region

SCOP Domain Sequences for d1n4xi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4xi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvs

SCOP Domain Coordinates for d1n4xi_:

Click to download the PDB-style file with coordinates for d1n4xi_.
(The format of our PDB-style files is described here.)

Timeline for d1n4xi_: