| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries) Uniprot P01901 22-299 |
| Domain d1n3ng1: 1n3n G:182-276 [85312] Other proteins in same PDB: d1n3na2, d1n3nb_, d1n3nc2, d1n3nd_, d1n3ne2, d1n3nf_, d1n3ng2, d1n3nh_ complexed with so4 |
PDB Entry: 1n3n (more details), 3 Å
SCOPe Domain Sequences for d1n3ng1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n3ng1 b.1.1.2 (G:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep
Timeline for d1n3ng1: