SCOP 1.75: Domain d1n3nd_: 1n3n D:

Lineage for d1n3nd_ (1n3n D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d1n3nd_: 1n3n D: [85308]
   Other proteins in same PDB: d1n3na1, d1n3na2, d1n3nc1, d1n3nc2, d1n3ne1, d1n3ne2, d1n3ng1, d1n3ng2

Details for d1n3nd_

PDB Entry: 1n3n, 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db

PDB Compounds: (D:) Beta-2-microglobulin

SCOP Domain Sequences for d1n3nd_:

Sequence; same for both SEQRES and ATOM records:

>d1n3nd_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1n3nd_:

• d1n3nd_ first appeared in SCOP 1.65
  
• d1n3nd_ appears in SCOP 1.73
  
• d1n3nd_ appears in SCOPe 2.01
  
• d1n3nd_ appears in the current release, SCOPe 2.08