Lineage for d1n3nd_ (1n3n D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746688Domain d1n3nd_: 1n3n D: [85308]
    Other proteins in same PDB: d1n3na1, d1n3na2, d1n3nc1, d1n3nc2, d1n3ne1, d1n3ne2, d1n3ng1, d1n3ng2
    complexed with so4

Details for d1n3nd_

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d1n3nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3nd_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1n3nd_:

Click to download the PDB-style file with coordinates for d1n3nd_.
(The format of our PDB-style files is described here.)

Timeline for d1n3nd_: