Lineage for d1n3nc2 (1n3n C:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545067Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)
  8. 2545118Domain d1n3nc2: 1n3n C:1-181 [85307]
    Other proteins in same PDB: d1n3na1, d1n3nb_, d1n3nc1, d1n3nd_, d1n3ne1, d1n3nf_, d1n3ng1, d1n3nh_
    complexed with so4

Details for d1n3nc2

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db
PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1n3nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3nc2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1n3nc2:

Click to download the PDB-style file with coordinates for d1n3nc2.
(The format of our PDB-style files is described here.)

Timeline for d1n3nc2: