Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries) |
Domain d1n3nb_: 1n3n B: [85305] Other proteins in same PDB: d1n3na1, d1n3na2, d1n3nc1, d1n3nc2, d1n3ne1, d1n3ne2, d1n3ng1, d1n3ng2 |
PDB Entry: 1n3n (more details), 3 Å
SCOP Domain Sequences for d1n3nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n3nb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1n3nb_: