Lineage for d1n3na2 (1n3n A:1-181)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409372Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)
  7. 409478Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 409515Domain d1n3na2: 1n3n A:1-181 [85304]
    Other proteins in same PDB: d1n3na1, d1n3nb_, d1n3nc1, d1n3nd_, d1n3ne1, d1n3nf_, d1n3ng1, d1n3nh_

Details for d1n3na2

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db

SCOP Domain Sequences for d1n3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3na2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1n3na2:

Click to download the PDB-style file with coordinates for d1n3na2.
(The format of our PDB-style files is described here.)

Timeline for d1n3na2: