Lineage for d1n3na1 (1n3n A:182-276)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358446Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2358594Domain d1n3na1: 1n3n A:182-276 [85303]
    Other proteins in same PDB: d1n3na2, d1n3nb_, d1n3nc2, d1n3nd_, d1n3ne2, d1n3nf_, d1n3ng2, d1n3nh_
    complexed with so4

Details for d1n3na1

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1n3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOPe Domain Coordinates for d1n3na1:

Click to download the PDB-style file with coordinates for d1n3na1.
(The format of our PDB-style files is described here.)

Timeline for d1n3na1: