Lineage for d1n3na1 (1n3n A:182-276)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548690Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries)
  8. 548781Domain d1n3na1: 1n3n A:182-276 [85303]
    Other proteins in same PDB: d1n3na2, d1n3nb_, d1n3nc2, d1n3nd_, d1n3ne2, d1n3nf_, d1n3ng2, d1n3nh_

Details for d1n3na1

PDB Entry: 1n3n (more details), 3 Å

PDB Description: Crystal structure of a mycobacterial hsp60 epitope with the murine class I MHC molecule H-2Db

SCOP Domain Sequences for d1n3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOP Domain Coordinates for d1n3na1:

Click to download the PDB-style file with coordinates for d1n3na1.
(The format of our PDB-style files is described here.)

Timeline for d1n3na1: