Lineage for d1n3fh_ (1n3f H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207154Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2207165Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2207166Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2207173Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 2207174Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
    Uniprot P05725 2-154 ! Uniprot P05725
  8. 2207182Domain d1n3fh_: 1n3f H: [85302]
    protein/DNA complex; complexed with ca

Details for d1n3fh_

PDB Entry: 1n3f (more details), 2 Å

PDB Description: Crystal structure of I-CreI bound to a palindromic DNA sequence II (palindrome of right side of wildtype DNA target sequence)
PDB Compounds: (H:) DNA endonuclease I-crei

SCOPe Domain Sequences for d1n3fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3fh_ d.95.2.1 (H:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvrav

SCOPe Domain Coordinates for d1n3fh_:

Click to download the PDB-style file with coordinates for d1n3fh_.
(The format of our PDB-style files is described here.)

Timeline for d1n3fh_: