Lineage for d1n3fh_ (1n3f H:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416232Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 416239Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 416240Family d.95.2.1: Group I mobile intron endonuclease [55609] (4 proteins)
    contains two extra helices in the C-terminal extension
  6. 416245Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 416246Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (7 PDB entries)
  8. 416252Domain d1n3fh_: 1n3f H: [85302]
    complexed with ca

Details for d1n3fh_

PDB Entry: 1n3f (more details), 2 Å

PDB Description: Crystal structure of I-CreI bound to a palindromic DNA sequence II (palindrome of right side of wildtype DNA target sequence)

SCOP Domain Sequences for d1n3fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3fh_ d.95.2.1 (H:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvrav

SCOP Domain Coordinates for d1n3fh_:

Click to download the PDB-style file with coordinates for d1n3fh_.
(The format of our PDB-style files is described here.)

Timeline for d1n3fh_: