| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
| Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
| Protein DNA endonuclease I-CreI [55610] (1 species) |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries) Uniprot P05725 2-154 ! Uniprot P05725 |
| Domain d1n3fb_: 1n3f B: [85300] protein/DNA complex; complexed with ca |
PDB Entry: 1n3f (more details), 2 Å
SCOPe Domain Sequences for d1n3fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n3fb_ d.95.2.1 (B:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvrav
Timeline for d1n3fb_: