Lineage for d1n3eg_ (1n3e G:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 508678Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 508685Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 508686Family d.95.2.1: Group I mobile intron endonuclease [55609] (4 proteins)
    contains two extra helices in the C-terminal extension
  6. 508691Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 508692Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (7 PDB entries)
  8. 508703Domain d1n3eg_: 1n3e G: [85297]

Details for d1n3eg_

PDB Entry: 1n3e (more details), 2.5 Å

PDB Description: Crystal structure of I-CreI bound to a palindromic DNA sequence I (palindrome of left side of wildtype DNA target sequence)

SCOP Domain Sequences for d1n3eg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3eg_ d.95.2.1 (G:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvravld

SCOP Domain Coordinates for d1n3eg_:

Click to download the PDB-style file with coordinates for d1n3eg_.
(The format of our PDB-style files is described here.)

Timeline for d1n3eg_: