SCOP 1.73: Domain d1n3eb_: 1n3e B:

Lineage for d1n3eb_ (1n3e B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (2 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
   contains two extra helices in the C-terminal extension

6. Protein DNA endonuclease I-CreI [55610] (1 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (11 PDB entries)

8. Domain d1n3eb_: 1n3e B: [85296]

Details for d1n3eb_

PDB Entry: 1n3e, 2.5 Å

PDB Description: Crystal structure of I-CreI bound to a palindromic DNA sequence I (palindrome of left side of wildtype DNA target sequence)

PDB Compounds: (B:) DNA endonuclease I-crei

SCOP Domain Sequences for d1n3eb_:

Sequence; same for both SEQRES and ATOM records:

>d1n3eb_ d.95.2.1 (B:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii [TaxId: 3055]}
tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
levctwvdqiaalndsktrkttsetvravld

Timeline for d1n3eb_:

• d1n3eb_ first appeared in SCOP 1.65
  
• d1n3eb_ appears in SCOP 1.71
  
• d1n3eb_ appears in SCOP 1.75
  
• d1n3eb_ appears in the current release, SCOPe 2.08