Lineage for d1n3ca2 (1n3c A:12-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975321Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2975362Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 2975363Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 2975381Domain d1n3ca2: 1n3c A:12-135 [85294]
    Other proteins in same PDB: d1n3ca1, d1n3ca3
    protein/DNA complex; complexed with ca

Details for d1n3ca2

PDB Entry: 1n3c (more details), 2.7 Å

PDB Description: structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d1n3ca2:

Sequence, based on SEQRES records: (download)

>d1n3ca2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records): (download)

>d1n3ca2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

SCOPe Domain Coordinates for d1n3ca2:

Click to download the PDB-style file with coordinates for d1n3ca2.
(The format of our PDB-style files is described here.)

Timeline for d1n3ca2: