Lineage for d1n3aa1 (1n3a A:136-325)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006213Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2006254Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 2006255Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)
  8. 2006266Domain d1n3aa1: 1n3a A:136-325 [85291]
    Other proteins in same PDB: d1n3aa2, d1n3aa3
    protein/DNA complex; complexed with ca

Details for d1n3aa1

PDB Entry: 1n3a (more details), 2.2 Å

PDB Description: Structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d1n3aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3aa1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvqvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d1n3aa1:

Click to download the PDB-style file with coordinates for d1n3aa1.
(The format of our PDB-style files is described here.)

Timeline for d1n3aa1: