SCOPe 2.07: Domain d1n39a2: 1n39 A:12-135

Lineage for d1n39a2 (1n39 A:12-135)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)

8. Domain d1n39a2: 1n39 A:12-135 [85290]
   Other proteins in same PDB: d1n39a1, d1n39a3
   protein/DNA complex; complexed with ca

Details for d1n39a2

PDB Entry: 1n39, 2.2 Å

PDB Description: structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d1n39a2:

Sequence, based on SEQRES records:

>d1n39a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records):

>d1n39a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

Timeline for d1n39a2:

• d1n39a2 first appeared in SCOP 1.65
  
• d1n39a2 appears in SCOPe 2.06
  
• d1n39a2 appears in the current release, SCOPe 2.08