SCOP 1.67: Domain d1n39a2: 1n39 A:9-135

Lineage for d1n39a2 (1n39 A:9-135)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.129: TBP-like [55944] (7 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (12 PDB entries)

8. Domain d1n39a2: 1n39 A:9-135 [85290]
   Other proteins in same PDB: d1n39a1
   complexed with 3dr, ca; mutant

Details for d1n39a2

PDB Entry: 1n39, 2.2 Å

PDB Description: structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase

SCOP Domain Sequences for d1n39a2:

Sequence, based on SEQRES records:

>d1n39a2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records):

>d1n39a2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Timeline for d1n39a2:

• d1n39a2 first appeared in SCOP 1.65
  
• d1n39a2 appears in SCOP 1.69
  
• d1n39a2 appears in the current release, SCOPe 2.08