SCOP 1.73: Domain d1n39a1: 1n39 A:136-325

Lineage for d1n39a1 (1n39 A:136-325)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries)

8. Domain d1n39a1: 1n39 A:136-325 [85289]
   Other proteins in same PDB: d1n39a2
   complexed with 3dr, ca; mutant

Details for d1n39a1

PDB Entry: 1n39, 2.2 Å

PDB Description: structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOP Domain Sequences for d1n39a1:

Sequence; same for both SEQRES and ATOM records:

>d1n39a1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvevhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d1n39a1:

• d1n39a1 first appeared in SCOP 1.65
  
• d1n39a1 appears in SCOP 1.71
  
• d1n39a1 appears in SCOP 1.75
  
• d1n39a1 appears in the current release, SCOPe 2.08