Lineage for d1n2va_ (1n2v A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825956Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 1825957Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 1825968Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 1825994Species Zymomonas mobilis [TaxId:542] [51716] (87 PDB entries)
    Uniprot P28720
  8. 1826069Domain d1n2va_: 1n2v A: [85288]
    complexed with bdi, zn

Details for d1n2va_

PDB Entry: 1n2v (more details), 2.1 Å

PDB Description: crystal structure of tgt in complex with 2-butyl-5,6-dihydro-1h- imidazo[4,5-d]pyridazine-4,7-dione
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d1n2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2va_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1n2va_:

Click to download the PDB-style file with coordinates for d1n2va_.
(The format of our PDB-style files is described here.)

Timeline for d1n2va_: