SCOPe 2.07: Domain d1n2ja_: 1n2j A:

Lineage for d1n2ja_ (1n2j A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries)

8. Domain d1n2ja_: 1n2j A: [85276]
   structural genomics
   complexed with bal, eoh, gol, paf, so4

Details for d1n2ja_

PDB Entry: 1n2j, 1.8 Å

PDB Description: crystal structure of a pantothenate synthetase from m. tuberculosis in complex with pantoate

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d1n2ja_:

Sequence; same for both SEQRES and ATOM records:

>d1n2ja_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigt

Timeline for d1n2ja_:

• d1n2ja_ first appeared in SCOP 1.65
  
• d1n2ja_ appears in SCOPe 2.06
  
• d1n2ja_ appears in the current release, SCOPe 2.08