Lineage for d1n2gb_ (1n2g B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482640Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
  6. 482641Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (3 species)
  7. 482645Species Mycobacterium tuberculosis [TaxId:1773] [89615] (8 PDB entries)
  8. 482655Domain d1n2gb_: 1n2g B: [85271]
    structural genomics

Details for d1n2gb_

PDB Entry: 1n2g (more details), 1.8 Å

PDB Description: crystal structure of a pantothenate synthetase from m. tuberculosis in complex with ampcpp

SCOP Domain Sequences for d1n2gb_:

Sequence, based on SEQRES records: (download)

>d1n2gb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis}
aipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsv
vvvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpg
plaaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvav
vgvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravlda
apgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieig

Sequence, based on observed residues (ATOM records): (download)

>d1n2gb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis}
aipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsv
vvvsifvnpmqfgaldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgpla
aeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvgv
ptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaapg
vavdylelrdiglgpmplngsgrllvaarlgttrlldniaieig

SCOP Domain Coordinates for d1n2gb_:

Click to download the PDB-style file with coordinates for d1n2gb_.
(The format of our PDB-style files is described here.)

Timeline for d1n2gb_: