SCOP 1.69: Domain d1n2ba_: 1n2b A:

Lineage for d1n2ba_ (1n2b A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89615] (8 PDB entries)

8. Domain d1n2ba_: 1n2b A: [85266]

Details for d1n2ba_

PDB Entry: 1n2b, 1.7 Å

PDB Description: crystal structure of a pantothenate synthetase from m. tuberculosis in complex with ampcpp and pantoate, higher occupancy of pantoate and lower occupancy of ampcpp in subunit a

SCOP Domain Sequences for d1n2ba_:

Sequence; same for both SEQRES and ATOM records:

>d1n2ba_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieig

Timeline for d1n2ba_:

• d1n2ba_ first appeared in SCOP 1.65
  
• d1n2ba_ appears in SCOP 1.67
  
• d1n2ba_ appears in SCOP 1.71
  
• d1n2ba_ appears in the current release, SCOPe 2.08