![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (14 species) |
![]() | Species Bacillus brevis, Dps [TaxId:1393] [89026] (1 PDB entry) |
![]() | Domain d1n1qc_: 1n1q C: [85262] complexed with feo |
PDB Entry: 1n1q (more details), 2.2 Å
SCOPe Domain Sequences for d1n1qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1qc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]} siqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtlaer vlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvadeadd eatadmldaieaglekhvwmleafle
Timeline for d1n1qc_: