SCOPe 2.01: Domain d1n1qc_: 1n1q C:

Lineage for d1n1qc_ (1n1q C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Bacillus brevis, Dps [TaxId:1393] [89026] (1 PDB entry)

8. Domain d1n1qc_: 1n1q C: [85262]
   complexed with feo

Details for d1n1qc_

PDB Entry: 1n1q, 2.2 Å

PDB Description: crystal structure of a dps protein from bacillus brevis

PDB Compounds: (C:) DPS Protein

SCOPe Domain Sequences for d1n1qc_:

Sequence; same for both SEQRES and ATOM records:

>d1n1qc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]}
siqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtlaer
vlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvadeadd
eatadmldaieaglekhvwmleafle

Timeline for d1n1qc_:

• d1n1qc_ first appeared in SCOP 1.65
  
• d1n1qc_ appears in SCOP 1.75
  
• d1n1qc_ appears in SCOPe 2.02
  
• d1n1qc_ appears in the current release, SCOPe 2.08