Lineage for d1n1qb_ (1n1q B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441062Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 441196Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 441219Species Bacillus brevis, Dps [TaxId:1393] [89026] (1 PDB entry)
  8. 441221Domain d1n1qb_: 1n1q B: [85261]

Details for d1n1qb_

PDB Entry: 1n1q (more details), 2.2 Å

PDB Description: crystal structure of a dps protein from bacillus brevis

SCOP Domain Sequences for d1n1qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1qb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Bacillus brevis, Dps}
mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
addeatadmldaieaglekhvwmleafle

SCOP Domain Coordinates for d1n1qb_:

Click to download the PDB-style file with coordinates for d1n1qb_.
(The format of our PDB-style files is described here.)

Timeline for d1n1qb_: