Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (14 species) |
Species Bacillus brevis, Dps [TaxId:1393] [89026] (1 PDB entry) |
Domain d1n1qa_: 1n1q A: [85260] complexed with feo |
PDB Entry: 1n1q (more details), 2.2 Å
SCOPe Domain Sequences for d1n1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1qa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]} mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade addeatadmldaieaglekhvwmleafle
Timeline for d1n1qa_: