SCOP 1.71: Domain d1n1eb2: 1n1e B:9-197

Lineage for d1n1eb2 (1n1e B:9-197)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Glycerol-3- phosphate dehydrogenase [51881] (2 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (7 PDB entries)

8. Domain d1n1eb2: 1n1e B:9-197 [85259]
   Other proteins in same PDB: d1n1ea1, d1n1eb1
   complexed with nde

Details for d1n1eb2

PDB Entry: 1n1e, 1.9 Å

PDB Description: Crystal structure of Leishmania mexicana Glycerol-3-phosphate dehydrogenase complexed with DHAP and NAD

SCOP Domain Sequences for d1n1eb2:

Sequence; same for both SEQRES and ATOM records:

>d1n1eb2 c.2.1.6 (B:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana)}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
drsfvcwat

Timeline for d1n1eb2:

• d1n1eb2 first appeared in SCOP 1.65
  
• d1n1eb2 appears in SCOP 1.69
  
• d1n1eb2 appears in SCOP 1.73
  
• d1n1eb2 appears in the current release, SCOPe 2.08