SCOP 1.69: Domain d1n1eb1: 1n1e B:198-357

Lineage for d1n1eb1 (1n1e B:198-357)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.6: Glycerol-3-phosphate dehydrogenase [48197] (1 protein)

6. Protein Glycerol-3-phosphate dehydrogenase [48198] (1 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [48199] (7 PDB entries)

8. Domain d1n1eb1: 1n1e B:198-357 [85258]
   Other proteins in same PDB: d1n1ea2, d1n1eb2

Details for d1n1eb1

PDB Entry: 1n1e, 1.9 Å

PDB Description: Crystal structure of Leishmania mexicana Glycerol-3-phosphate dehydrogenase complexed with DHAP and NAD

SCOP Domain Sequences for d1n1eb1:

Sequence; same for both SEQRES and ATOM records:

>d1n1eb1 a.100.1.6 (B:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana)}
tdtvgcevasavknvlaigsgvanglgmglnaraalimrglleirdltaalggdgsavfg
laglgdlqltcsselsrnftvgkklgkglpieeiqrtskavaegvatadplmrlakqlkv
kmplchqiyeivykkknprdaladllscglqdeglpplfk

Timeline for d1n1eb1:

• d1n1eb1 first appeared in SCOP 1.65
  
• d1n1eb1 appears in SCOP 1.67
  
• d1n1eb1 appears in SCOP 1.71
  
• d1n1eb1 appears in the current release, SCOPe 2.08