Lineage for d1n1ea1 (1n1e A:198-357)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541599Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 541600Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (10 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 541703Family a.100.1.6: Glycerol-3-phosphate dehydrogenase [48197] (1 protein)
  6. 541704Protein Glycerol-3-phosphate dehydrogenase [48198] (2 species)
  7. 541708Species Trypanosome (Leishmania mexicana) [TaxId:5665] [48199] (7 PDB entries)
  8. 541712Domain d1n1ea1: 1n1e A:198-357 [85256]
    Other proteins in same PDB: d1n1ea2, d1n1eb2

Details for d1n1ea1

PDB Entry: 1n1e (more details), 1.9 Å

PDB Description: Crystal structure of Leishmania mexicana Glycerol-3-phosphate dehydrogenase complexed with DHAP and NAD

SCOP Domain Sequences for d1n1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana)}
tdtvgcevasavknvlaigsgvanglgmglnaraalimrglleirdltaalggdgsavfg
laglgdlqltcsselsrnftvgkklgkglpieeiqrtskavaegvatadplmrlakqlkv
kmplchqiyeivykkknprdaladllscglqdeglpplfk

SCOP Domain Coordinates for d1n1ea1:

Click to download the PDB-style file with coordinates for d1n1ea1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1ea2