Lineage for d1n1ca1 (1n1c A:4-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014370Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2014371Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2014372Family a.184.1.1: TorD-like [89156] (5 protein domains)
    Pfam PF06192
  6. 2014384Protein TorA specific chaperone TorD [89157] (1 species)
    segment-swapped dimer
  7. 2014385Species Shewanella massilia [TaxId:76854] [89158] (1 PDB entry)
  8. 2014386Domain d1n1ca1: 1n1c A:4-209 [85254]
    Other proteins in same PDB: d1n1ca2, d1n1cb2
    complexed with dtt

Details for d1n1ca1

PDB Entry: 1n1c (more details), 2.4 Å

PDB Description: Crystal Structure Of The Dimeric TorD Chaperone From Shewanella Massilia
PDB Compounds: (A:) TorA specific chaperone

SCOPe Domain Sequences for d1n1ca1:

Sequence, based on SEQRES records: (download)

>d1n1ca1 a.184.1.1 (A:4-209) TorA specific chaperone TorD {Shewanella massilia [TaxId: 76854]}
vdinparalvyqllsslfarevdeqrlkeltseaaqqfweqlsleanftqsvdkirstln
gikddeallelaadycglflvgtkhsaspyaslylsgedepllfgeqhqqmseflhqskl
qvqshfpepadhlavmlaymahlcchsensvqlsflqtcvnswlakfinhltqcnkngfy
savatltlawvkqdiaqlepavaiis

Sequence, based on observed residues (ATOM records): (download)

>d1n1ca1 a.184.1.1 (A:4-209) TorA specific chaperone TorD {Shewanella massilia [TaxId: 76854]}
vdinparalvyqllsslfarevdeqrlkeltseaaqqfweqlsleanftqsvdkirstln
gikddeallelaadycglflvgtsaspyaslylllfgeqhqqmseflhqsklqvqshfpe
padhlavmlaymahlcchsensvqlsflqtcvnswlakfinhltqcnkngfysavatltl
awvkqdiaqlepavaiis

SCOPe Domain Coordinates for d1n1ca1:

Click to download the PDB-style file with coordinates for d1n1ca1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n1ca2