SCOP 1.71: Domain d1n13.4: 1n13 G:,H:

Lineage for d1n13.4 (1n13 G:,H:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
   duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich

4. Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families)
   two chains result from self-processing single-chain precursor; form heterohexamer

5. Family d.155.1.2: Arginine decarboxylase [90046] (1 protein)

6. Protein Arginine decarboxylase [90047] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)

8. Domain d1n13.4: 1n13 G:,H: [85251]

Details for d1n13.4

PDB Entry: 1n13, 1.4 Å

PDB Description: The Crystal Structure of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannashii

SCOP Domain Sequences for d1n13.4:

Sequence; same for both SEQRES and ATOM records:

>g1n13.4 d.155.1.2 (G:,H:) Arginine decarboxylase {Archaeon Methanococcus jannaschii}
fklpntvslvagssegetplnafdgallnagignvnlirisXimppeaeivplpklpmga
lvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakigf
emrgweldriesiavehtveklgcafaaaalwyk

Timeline for d1n13.4:

• d1n13.4 first appeared in SCOP 1.65
  
• d1n13.4 appears in SCOP 1.69
  
• d1n13.4 appears in SCOP 1.73
  
• d1n13.4 appears in the current release, SCOPe 2.08