Lineage for d1n13.3 (1n13 E:,F:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513303Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
    duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich
  4. 513304Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) (S)
    two chains result from self-processing single-chain precursor; form heterohexamer
  5. 513325Family d.155.1.2: Arginine decarboxylase [90046] (1 protein)
  6. 513326Protein Arginine decarboxylase [90047] (1 species)
  7. 513327Species Archaeon Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)
  8. 513330Domain d1n13.3: 1n13 E:,F: [85250]

Details for d1n13.3

PDB Entry: 1n13 (more details), 1.4 Å

PDB Description: The Crystal Structure of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannashii

SCOP Domain Sequences for d1n13.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1n13.3 d.155.1.2 (E:,F:) Arginine decarboxylase {Archaeon Methanococcus jannaschii}
aeinplhayfklpntvslvagssegetplnafdgallnagignvnlirisXimppeaeiv
plpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaekt
vremakigfemrgweldriesiavehtveklgcafaaaalwyk

SCOP Domain Coordinates for d1n13.3:

Click to download the PDB-style file with coordinates for d1n13.3.
(The format of our PDB-style files is described here.)

Timeline for d1n13.3: