Lineage for d1n13.2 (1n13 C:,D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937588Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
    duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich
  4. 1937589Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) (S)
    two chains result from self-processing single-chain precursor; form heterohexamer
  5. 1937610Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins)
  6. 1937611Protein Arginine decarboxylase [90047] (1 species)
  7. 1937612Species Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)
  8. 1937614Domain d1n13.2: 1n13 C:,D: [85249]
    complexed with ag2, mrd

Details for d1n13.2

PDB Entry: 1n13 (more details), 1.4 Å

PDB Description: The Crystal Structure of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannashii
PDB Compounds: (C:) pyruvoyl-dependent arginine decarboxylase beta chain, (D:) pyruvoyl-dependent arginine decarboxylase alpha chain

SCOPe Domain Sequences for d1n13.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1n13.2 d.155.1.2 (C:,D:) Arginine decarboxylase {Methanococcus jannaschii [TaxId: 2190]}
inplhayfklpntvslvagssegetplnafdgallnagignvnlirisXximppeaeivp
lpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektv
remakigfemrgweldriesiavehtveklgcafaaaalwyk

SCOPe Domain Coordinates for d1n13.2:

Click to download the PDB-style file with coordinates for d1n13.2.
(The format of our PDB-style files is described here.)

Timeline for d1n13.2: