| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily) duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich |
Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) ![]() two chains result from self-processing single-chain precursor; form heterohexamer |
| Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins) |
| Protein Arginine decarboxylase [90047] (1 species) |
| Species Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries) |
| Domain d1n13.2: 1n13 C:,D: [85249] complexed with ag2, mrd |
PDB Entry: 1n13 (more details), 1.4 Å
SCOPe Domain Sequences for d1n13.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1n13.2 d.155.1.2 (C:,D:) Arginine decarboxylase {Methanococcus jannaschii [TaxId: 2190]}
inplhayfklpntvslvagssegetplnafdgallnagignvnlirisXximppeaeivp
lpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektv
remakigfemrgweldriesiavehtveklgcafaaaalwyk
Timeline for d1n13.2: