|  | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) | 
|  | Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily) duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich | 
|  | Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families)  two chains result from self-processing single-chain precursor; form heterohexamer | 
|  | Family d.155.1.2: Arginine decarboxylase [90046] (1 protein) | 
|  | Protein Arginine decarboxylase [90047] (1 species) | 
|  | Species Archaeon Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries) | 
|  | Domain d1n13.1: 1n13 A:,B: [85248] | 
PDB Entry: 1n13 (more details), 1.4 Å
SCOP Domain Sequences for d1n13.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1n13.1 d.155.1.2 (A:,B:) Arginine decarboxylase {Archaeon Methanococcus jannaschii}
plhayfklpntvslvagssegetplnafdgallnagignvnlirisXimppeaeivplpk
lpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvrem
akigfemrgweldriesiavehtveklgcafaaaalwyk
Timeline for d1n13.1: