Lineage for d1n0ia_ (1n0i A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160865Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2160866Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2160867Protein Ferrochelatase [53802] (3 species)
  7. 2160868Species Bacillus subtilis [TaxId:1423] [53803] (15 PDB entries)
  8. 2160877Domain d1n0ia_: 1n0i A: [85242]
    complexed with cd, cl, mg

Details for d1n0ia_

PDB Entry: 1n0i (more details), 2 Å

PDB Description: crystal structure of ferrochelatase with cadmium bound at active site
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d1n0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0ia_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
tvvlkklgr

SCOPe Domain Coordinates for d1n0ia_:

Click to download the PDB-style file with coordinates for d1n0ia_.
(The format of our PDB-style files is described here.)

Timeline for d1n0ia_: