Lineage for d1mzcb_ (1mzc B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542077Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 542078Species Human (Homo sapiens) [TaxId:9606] [69090] (14 PDB entries)
  8. 542082Domain d1mzcb_: 1mzc B: [85240]
    Other proteins in same PDB: d1mzca_
    complexed with bne, fpp, suc, zn

Details for d1mzcb_

PDB Entry: 1mzc (more details), 2 Å

PDB Description: co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 33a

SCOP Domain Sequences for d1mzcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzcb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
eggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgf

SCOP Domain Coordinates for d1mzcb_:

Click to download the PDB-style file with coordinates for d1mzcb_.
(The format of our PDB-style files is described here.)

Timeline for d1mzcb_: