Lineage for d1mzca_ (1mzc A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279115Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 1279116Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 1279117Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 1279118Species Human (Homo sapiens) [TaxId:9606] [69093] (13 PDB entries)
    Uniprot P49354
  8. 1279126Domain d1mzca_: 1mzc A: [85239]
    Other proteins in same PDB: d1mzcb_
    complexed with bne, fpp, suc, zn

Details for d1mzca_

PDB Entry: 1mzc (more details), 2 Å

PDB Description: co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 33a
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1mzca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzca_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskh

SCOPe Domain Coordinates for d1mzca_:

Click to download the PDB-style file with coordinates for d1mzca_.
(The format of our PDB-style files is described here.)

Timeline for d1mzca_: