Lineage for d1mz0a_ (1mz0 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276464Protein Myoglobin [46469] (9 species)
  7. 276535Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (143 PDB entries)
  8. 276553Domain d1mz0a_: 1mz0 A: [85238]
    combined rietveld and stereochemical restraint refinement
    complexed with cmo, hem, sul; mutant

Details for d1mz0a_

PDB Entry: 1mz0 (more details), 1.6 Å

PDB Description: structure of myoglobin mb-yqr 316 ns after photolysis of carbon monoxide solved from laue data at rt.

SCOP Domain Sequences for d1mz0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz0a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1mz0a_:

Click to download the PDB-style file with coordinates for d1mz0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mz0a_: