SCOP 1.65: Domain d1my8a_: 1my8 A:

Lineage for d1my8a_ (1my8 A:)

1. Root: SCOP 1.65

2. Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (29 PDB entries)

8. Domain d1my8a_: 1my8 A: [85236]

Details for d1my8a_

PDB Entry: 1my8, 1.72 Å

PDB Description: AmpC beta-lactamase in complex with an M.carboxyphenylglycylboronic acid bearing the cephalothin R1 side chain

SCOP Domain Sequences for d1my8a_:

Sequence; same for both SEQRES and ATOM records:

>d1my8a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1my8a_:

• d1my8a_ is new in SCOP 1.65
  
• d1my8a_ appears in SCOP 1.67
  
• d1my8a_ appears in the current release, SCOPe 2.08