![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [89910] (1 PDB entry) |
![]() | Domain d1my6a2: 1my6 A:89-198 [85233] Other proteins in same PDB: d1my6a1, d1my6b1 complexed with fe |
PDB Entry: 1my6 (more details), 1.6 Å
SCOPe Domain Sequences for d1my6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} ggggvptgdvaarinsafgsydefkaqfknaaatqfgsgwawlvleagtlkvtktanaen plvhgqvplltidvwehayyldyqnrrpdfidnflnqlvnwdfvaknlaa
Timeline for d1my6a2: