SCOPe 2.07: Domain d1my6a1: 1my6 A:1-88

Lineage for d1my6a1 (1my6 A:1-88)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [88971] (1 PDB entry)

8. Domain d1my6a1: 1my6 A:1-88 [85232]
   Other proteins in same PDB: d1my6a2, d1my6b2
   complexed with fe

Details for d1my6a1

PDB Entry: 1my6, 1.6 Å

PDB Description: The 1.6 A Structure of Fe-Superoxide Dismutase from the thermophilic cyanobacterium Thermosynechococcus elongatus : Correlation of EPR and Structural Characteristics

PDB Compounds: (A:) Iron (III) Superoxide Dismutase

SCOPe Domain Sequences for d1my6a1:

Sequence; same for both SEQRES and ATOM records:

>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]}
afvqeplpfdpgalepygmsaktlefhygkhhkgyvdnlnkltqdteladksledvirtt
ygdaakvgifnnaaqvwnhtffwnslkp

Timeline for d1my6a1:

• d1my6a1 first appeared in SCOP 1.65
  
• d1my6a1 appears in SCOPe 2.06
  
• d1my6a1 appears in the current release, SCOPe 2.08