![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [88971] (1 PDB entry) |
![]() | Domain d1my6a1: 1my6 A:1-88 [85232] Other proteins in same PDB: d1my6a2, d1my6b2 complexed with fe |
PDB Entry: 1my6 (more details), 1.6 Å
SCOPe Domain Sequences for d1my6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} afvqeplpfdpgalepygmsaktlefhygkhhkgyvdnlnkltqdteladksledvirtt ygdaakvgifnnaaqvwnhtffwnslkp
Timeline for d1my6a1: