SCOPe 2.07: Domain d1my2a_: 1my2 A:

Lineage for d1my2a_ (1my2 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d1my2a_: 1my2 A: [85223]
   complexed with amq, zn

Details for d1my2a_

PDB Entry: 1my2, 1.8 Å

PDB Description: crystal titration experiment (ampa complex control)

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d1my2a_:

Sequence; same for both SEQRES and ATOM records:

>d1my2a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1my2a_:

• d1my2a_ first appeared in SCOP 1.65
  
• d1my2a_ appears in SCOPe 2.06
  
• d1my2a_ appears in the current release, SCOPe 2.08