Lineage for d1mxga1 (1mxg A:362-435)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2419912Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 2419958Species Pyrococcus woesei [TaxId:2262] [89383] (3 PDB entries)
  8. 2419959Domain d1mxga1: 1mxg A:362-435 [85193]
    Other proteins in same PDB: d1mxga2
    complexed with acr, ca, eoh, ete, mg, trs, zn

Details for d1mxga1

PDB Entry: 1mxg (more details), 1.6 Å

PDB Description: crystal structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1mxga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxga1 b.71.1.1 (A:362-435) Bacterial alpha-Amylase {Pyrococcus woesei [TaxId: 2262]}
pglityinlspnwvgrwvyvpkfagaciheytgnlggwvdkrvdssgwvyleapphdpan
gyygysvwsycgvg

SCOPe Domain Coordinates for d1mxga1:

Click to download the PDB-style file with coordinates for d1mxga1.
(The format of our PDB-style files is described here.)

Timeline for d1mxga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mxga2