SCOPe 2.08: Domain d1mxga1: 1mxg A:362-435

Lineage for d1mxga1 (1mxg A:362-435)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Pyrococcus woesei [TaxId:2262] [89383] (3 PDB entries)

8. Domain d1mxga1: 1mxg A:362-435 [85193]
   Other proteins in same PDB: d1mxga2
   complexed with ca, eoh, ete, mg, trs, zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1mxga1

PDB Entry: 1mxg, 1.6 Å

PDB Description: crystal structure of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose

PDB Compounds: (A:) alpha amylase

SCOPe Domain Sequences for d1mxga1:

Sequence; same for both SEQRES and ATOM records:

>d1mxga1 b.71.1.1 (A:362-435) Bacterial alpha-Amylase {Pyrococcus woesei [TaxId: 2262]}
pglityinlspnwvgrwvyvpkfagaciheytgnlggwvdkrvdssgwvyleapphdpan
gyygysvwsycgvg

Timeline for d1mxga1:

• d1mxga1 first appeared in SCOP 1.65
  
• d1mxga1 appears in SCOPe 2.07