Lineage for d1mx9d_ (1mx9 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134248Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)
  7. 2134249Species Human (Homo sapiens) [TaxId:9606] [89768] (7 PDB entries)
  8. 2134266Domain d1mx9d_: 1mx9 D: [85182]
    complexed with nag, nlx

Details for d1mx9d_

PDB Entry: 1mx9 (more details), 2.9 Å

PDB Description: Crystal Structure of Human Liver Carboxylesterase in complexed with naloxone methiodide, a heroin analogue
PDB Compounds: (D:) liver Carboxylesterase I

SCOPe Domain Sequences for d1mx9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx9d_ c.69.1.1 (D:) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakk

SCOPe Domain Coordinates for d1mx9d_:

Click to download the PDB-style file with coordinates for d1mx9d_.
(The format of our PDB-style files is described here.)

Timeline for d1mx9d_: