Lineage for d1mx9a_ (1mx9 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 319445Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 319446Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 319447Family c.69.1.1: Acetylcholinesterase-like [53475] (4 protein domains)
  6. 319524Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)
  7. 319525Species Human (Homo sapiens) [TaxId:9606] [89768] (3 PDB entries)
  8. 319538Domain d1mx9a_: 1mx9 A: [85179]

Details for d1mx9a_

PDB Entry: 1mx9 (more details), 2.9 Å

PDB Description: Crystal Structure of Human Liver Carboxylesterase in complexed with naloxone methiodide, a heroin analogue

SCOP Domain Sequences for d1mx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx9a_ c.69.1.1 (A:) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens)}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOP Domain Coordinates for d1mx9a_:

Click to download the PDB-style file with coordinates for d1mx9a_.
(The format of our PDB-style files is described here.)

Timeline for d1mx9a_: