Lineage for d1mx7a_ (1mx7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805041Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species)
  7. 2805042Species Norway rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries)
  8. 2805053Domain d1mx7a_: 1mx7 A: [85177]

Details for d1mx7a_

PDB Entry: 1mx7 (more details)

PDB Description: two homologous rat cellular retinol-binding proteins differ in local structure and flexibility
PDB Compounds: (A:) cellular retinol-binding protein I, apo

SCOPe Domain Sequences for d1mx7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx7a_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
aegvtckqvfkkvh

SCOPe Domain Coordinates for d1mx7a_:

Click to download the PDB-style file with coordinates for d1mx7a_.
(The format of our PDB-style files is described here.)

Timeline for d1mx7a_: