Lineage for d1mwvb1 (1mwv B:35-440)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093055Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1093056Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1093469Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 1093470Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 1093471Species Burkholderia pseudomallei [TaxId:28450] [89093] (14 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 1093474Domain d1mwvb1: 1mwv B:35-440 [85163]
    complexed with hem, na, peo

Details for d1mwvb1

PDB Entry: 1mwv (more details), 1.7 Å

PDB Description: crystal structure of catalase-peroxidase katg of burkholderia pseudomallei
PDB Compounds: (B:) catalase-peroxidase protein KatG

SCOPe Domain Sequences for d1mwvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwvb1 a.93.1.3 (B:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOPe Domain Coordinates for d1mwvb1:

Click to download the PDB-style file with coordinates for d1mwvb1.
(The format of our PDB-style files is described here.)

Timeline for d1mwvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwvb2